Anti STT3B pAb (ATL-HPA036646)

Atlas

Catalog No: ATL-HPA036646-25

• 
• 

Protein Description: STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
Gene Name: STT3B
Alternative Gene Name: FLJ90106, SIMP, STT3-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032437: 93%, ENSRNOG00000011922: 88%
Entrez Gene ID: 201595
Uniprot ID: Q8TCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
• Gene Sequence: NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
• Gene ID - Mouse: ENSMUSG00000032437
• Gene ID - Rat: ENSRNOG00000011922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STT3B pAb (ATL-HPA036646) – 2 Found

Matsuda-Lennikov, Mami; Biancalana, Matthew; Zou, Juan; Ravell, Juan C; Zheng, Lixin; Kanellopoulou, Chrysi; Jiang, Ping; Notarangelo, Giulia; Jing, Huie; Masutani, Evan; Oler, Andrew J; Olano, Lisa Renee; Schulz, Benjamin L; Lenardo, Michael J. Magnesium transporter 1 (MAGT1) deficiency causes selective defects in N-linked glycosylation and expression of immune-response genes. The Journal Of Biological Chemistry. 2019;294(37):13638-13656. 

Zhu, Shenglin; Wan, Weiwei; Zhang, Yanjun; Shang, Weijuan; Pan, Xiaoyan; Zhang, Lei-Ke; Xiao, Gengfu. Comprehensive Interactome Analysis Reveals that STT3B Is Required for N-Glycosylation of Lassa Virus Glycoprotein. Journal Of Virology. 2019;93(23)