Description
Product Description
Protein Description: STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
Gene Name: STT3B
Alternative Gene Name: FLJ90106, SIMP, STT3-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032437: 93%, ENSRNOG00000011922: 88%
Entrez Gene ID: 201595
Uniprot ID: Q8TCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STT3B
Alternative Gene Name: FLJ90106, SIMP, STT3-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032437: 93%, ENSRNOG00000011922: 88%
Entrez Gene ID: 201595
Uniprot ID: Q8TCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP |
Gene Sequence | NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP |
Gene ID - Mouse | ENSMUSG00000032437 |
Gene ID - Rat | ENSRNOG00000011922 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti STT3B pAb (ATL-HPA036646) | |
Datasheet | Anti STT3B pAb (ATL-HPA036646) Datasheet (External Link) |
Vendor Page | Anti STT3B pAb (ATL-HPA036646) at Atlas Antibodies |
Documents & Links for Anti STT3B pAb (ATL-HPA036646) | |
Datasheet | Anti STT3B pAb (ATL-HPA036646) Datasheet (External Link) |
Vendor Page | Anti STT3B pAb (ATL-HPA036646) |
Citations
Citations for Anti STT3B pAb (ATL-HPA036646) – 2 Found |
Matsuda-Lennikov, Mami; Biancalana, Matthew; Zou, Juan; Ravell, Juan C; Zheng, Lixin; Kanellopoulou, Chrysi; Jiang, Ping; Notarangelo, Giulia; Jing, Huie; Masutani, Evan; Oler, Andrew J; Olano, Lisa Renee; Schulz, Benjamin L; Lenardo, Michael J. Magnesium transporter 1 (MAGT1) deficiency causes selective defects in N-linked glycosylation and expression of immune-response genes. The Journal Of Biological Chemistry. 2019;294(37):13638-13656. PubMed |
Zhu, Shenglin; Wan, Weiwei; Zhang, Yanjun; Shang, Weijuan; Pan, Xiaoyan; Zhang, Lei-Ke; Xiao, Gengfu. Comprehensive Interactome Analysis Reveals that STT3B Is Required for N-Glycosylation of Lassa Virus Glycoprotein. Journal Of Virology. 2019;93(23) PubMed |