Anti STRN4 pAb (ATL-HPA056706 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056706-25

• 
• 

Product Description

Protein Description: striatin, calmodulin binding protein 4
Gene Name: STRN4
Alternative Gene Name: ZIN, zinedin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030374: 97%, ENSRNOG00000016145: 97%
Entrez Gene ID: 29888
Uniprot ID: Q9NRL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDE
• Gene Sequence: GLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDE
• Gene ID - Mouse: ENSMUSG00000030374
• Gene ID - Rat: ENSRNOG00000016145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.