Anti STRA6 pAb (ATL-HPA040839)

Catalog No:
ATL-HPA040839-25
$395.00

Description

Product Description

Protein Description: stimulated by retinoic acid 6
Gene Name: STRA6
Alternative Gene Name: FLJ12541
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032327: 70%, ENSRNOG00000008312: 70%
Entrez Gene ID: 64220
Uniprot ID: Q9BX79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP
Gene Sequence YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP
Gene ID - Mouse ENSMUSG00000032327
Gene ID - Rat ENSRNOG00000008312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STRA6 pAb (ATL-HPA040839)
Datasheet Anti STRA6 pAb (ATL-HPA040839) Datasheet (External Link)
Vendor Page Anti STRA6 pAb (ATL-HPA040839) at Atlas Antibodies

Documents & Links for Anti STRA6 pAb (ATL-HPA040839)
Datasheet Anti STRA6 pAb (ATL-HPA040839) Datasheet (External Link)
Vendor Page Anti STRA6 pAb (ATL-HPA040839)

Product Description

Protein Description: stimulated by retinoic acid 6
Gene Name: STRA6
Alternative Gene Name: FLJ12541
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032327: 70%, ENSRNOG00000008312: 70%
Entrez Gene ID: 64220
Uniprot ID: Q9BX79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP
Gene Sequence YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP
Gene ID - Mouse ENSMUSG00000032327
Gene ID - Rat ENSRNOG00000008312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STRA6 pAb (ATL-HPA040839)
Datasheet Anti STRA6 pAb (ATL-HPA040839) Datasheet (External Link)
Vendor Page Anti STRA6 pAb (ATL-HPA040839) at Atlas Antibodies

Documents & Links for Anti STRA6 pAb (ATL-HPA040839)
Datasheet Anti STRA6 pAb (ATL-HPA040839) Datasheet (External Link)
Vendor Page Anti STRA6 pAb (ATL-HPA040839)