Description
Product Description
Protein Description: stimulated by retinoic acid 6
Gene Name: STRA6
Alternative Gene Name: FLJ12541
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032327: 70%, ENSRNOG00000008312: 70%
Entrez Gene ID: 64220
Uniprot ID: Q9BX79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STRA6
Alternative Gene Name: FLJ12541
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032327: 70%, ENSRNOG00000008312: 70%
Entrez Gene ID: 64220
Uniprot ID: Q9BX79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP |
Gene Sequence | YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP |
Gene ID - Mouse | ENSMUSG00000032327 |
Gene ID - Rat | ENSRNOG00000008312 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti STRA6 pAb (ATL-HPA040839) | |
Datasheet | Anti STRA6 pAb (ATL-HPA040839) Datasheet (External Link) |
Vendor Page | Anti STRA6 pAb (ATL-HPA040839) at Atlas Antibodies |
Documents & Links for Anti STRA6 pAb (ATL-HPA040839) | |
Datasheet | Anti STRA6 pAb (ATL-HPA040839) Datasheet (External Link) |
Vendor Page | Anti STRA6 pAb (ATL-HPA040839) |