Protein Description: stathmin domain containing 1
Gene Name: STMND1
Alternative Gene Name: FLJ23152
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063529: 51%, ENSRNOG00000031595: 49%
Entrez Gene ID: 401236
Uniprot ID: H3BQB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STMND1
Alternative Gene Name: FLJ23152
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063529: 51%, ENSRNOG00000031595: 49%
Entrez Gene ID: 401236
Uniprot ID: H3BQB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQA |
| Documents & Links for Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation) | |
| Datasheet | Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation) at Atlas |
| Documents & Links for Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation) | |
| Datasheet | Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation) |