Anti STK39 pAb (ATL-HPA062802 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062802-25

• 

Product Description

Protein Description: serine threonine kinase 39
Gene Name: STK39
Alternative Gene Name: DCHT, SPAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027030: 81%, ENSRNOG00000024808: 84%
Entrez Gene ID: 27347
Uniprot ID: Q9UEW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ
• Gene Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ
• Gene ID - Mouse: ENSMUSG00000027030
• Gene ID - Rat: ENSRNOG00000024808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.