Description
Product Description
Protein Description: serine/threonine kinase 33
Gene Name: STK33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031027: 29%, ENSRNOG00000014590: 36%
Entrez Gene ID: 65975
Uniprot ID: Q9BYT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STK33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031027: 29%, ENSRNOG00000014590: 36%
Entrez Gene ID: 65975
Uniprot ID: Q9BYT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKS |
Gene Sequence | EEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKS |
Gene ID - Mouse | ENSMUSG00000031027 |
Gene ID - Rat | ENSRNOG00000014590 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti STK33 pAb (ATL-HPA056855) | |
Datasheet | Anti STK33 pAb (ATL-HPA056855) Datasheet (External Link) |
Vendor Page | Anti STK33 pAb (ATL-HPA056855) at Atlas Antibodies |
Documents & Links for Anti STK33 pAb (ATL-HPA056855) | |
Datasheet | Anti STK33 pAb (ATL-HPA056855) Datasheet (External Link) |
Vendor Page | Anti STK33 pAb (ATL-HPA056855) |