Protein Description: serine/threonine kinase 32A
Gene Name: STK32A
Alternative Gene Name: MGC22688, YANK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039954: 87%, ENSRNOG00000027066: 84%
Entrez Gene ID: 202374
Uniprot ID: Q8WU08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STK32A
Alternative Gene Name: MGC22688, YANK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039954: 87%, ENSRNOG00000027066: 84%
Entrez Gene ID: 202374
Uniprot ID: Q8WU08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP |
Gene ID - Mouse | ENSMUSG00000039954 |
Gene ID - Rat | ENSMUSG00000039954 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti STK32A pAb (ATL-HPA040236) | |
Datasheet | Anti STK32A pAb (ATL-HPA040236) Datasheet (External Link) |
Vendor Page | Anti STK32A pAb (ATL-HPA040236) at Atlas |
Documents & Links for Anti STK32A pAb (ATL-HPA040236) | |
Datasheet | Anti STK32A pAb (ATL-HPA040236) Datasheet (External Link) |
Vendor Page | Anti STK32A pAb (ATL-HPA040236) |