Anti STK32A pAb (ATL-HPA040236)

Catalog No:
ATL-HPA040236-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: serine/threonine kinase 32A
Gene Name: STK32A
Alternative Gene Name: MGC22688, YANK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039954: 87%, ENSRNOG00000027066: 84%
Entrez Gene ID: 202374
Uniprot ID: Q8WU08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP
Gene Sequence HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP
Gene ID - Mouse ENSMUSG00000039954
Gene ID - Rat ENSRNOG00000027066
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti STK32A pAb (ATL-HPA040236)
Datasheet Anti STK32A pAb (ATL-HPA040236) Datasheet (External Link)
Vendor Page Anti STK32A pAb (ATL-HPA040236) at Atlas

Documents & Links for Anti STK32A pAb (ATL-HPA040236)
Datasheet Anti STK32A pAb (ATL-HPA040236) Datasheet (External Link)
Vendor Page Anti STK32A pAb (ATL-HPA040236)