Anti STK19 pAb (ATL-HPA068559)

Catalog No:
ATL-HPA068559-25
$447.00

Description

Product Description

Protein Description: serine/threonine kinase 19
Gene Name: STK19
Alternative Gene Name: D6S60, G11, RP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061207: 86%, ENSRNOG00000019555: 23%
Entrez Gene ID: 8859
Uniprot ID: P49842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTR
Gene Sequence AAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTR
Gene ID - Mouse ENSMUSG00000061207
Gene ID - Rat ENSRNOG00000019555
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STK19 pAb (ATL-HPA068559)
Datasheet Anti STK19 pAb (ATL-HPA068559) Datasheet (External Link)
Vendor Page Anti STK19 pAb (ATL-HPA068559) at Atlas Antibodies

Documents & Links for Anti STK19 pAb (ATL-HPA068559)
Datasheet Anti STK19 pAb (ATL-HPA068559) Datasheet (External Link)
Vendor Page Anti STK19 pAb (ATL-HPA068559)

Product Description

Protein Description: serine/threonine kinase 19
Gene Name: STK19
Alternative Gene Name: D6S60, G11, RP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061207: 86%, ENSRNOG00000019555: 23%
Entrez Gene ID: 8859
Uniprot ID: P49842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTR
Gene Sequence AAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTR
Gene ID - Mouse ENSMUSG00000061207
Gene ID - Rat ENSRNOG00000019555
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STK19 pAb (ATL-HPA068559)
Datasheet Anti STK19 pAb (ATL-HPA068559) Datasheet (External Link)
Vendor Page Anti STK19 pAb (ATL-HPA068559) at Atlas Antibodies

Documents & Links for Anti STK19 pAb (ATL-HPA068559)
Datasheet Anti STK19 pAb (ATL-HPA068559) Datasheet (External Link)
Vendor Page Anti STK19 pAb (ATL-HPA068559)