Protein Description: serine/threonine kinase 19
Gene Name: STK19
Alternative Gene Name: D6S60, G11, RP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061207: 86%, ENSRNOG00000019555: 23%
Entrez Gene ID: 8859
Uniprot ID: P49842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STK19
Alternative Gene Name: D6S60, G11, RP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061207: 86%, ENSRNOG00000019555: 23%
Entrez Gene ID: 8859
Uniprot ID: P49842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTR |
| Documents & Links for Anti STK19 pAb (ATL-HPA068559) | |
| Datasheet | Anti STK19 pAb (ATL-HPA068559) Datasheet (External Link) |
| Vendor Page | Anti STK19 pAb (ATL-HPA068559) at Atlas |
| Documents & Links for Anti STK19 pAb (ATL-HPA068559) | |
| Datasheet | Anti STK19 pAb (ATL-HPA068559) Datasheet (External Link) |
| Vendor Page | Anti STK19 pAb (ATL-HPA068559) |