Anti STK11 pAb (ATL-HPA067481)

Catalog No:
ATL-HPA067481-25
$328.00

Description

Product Description

Protein Description: serine/threonine kinase 11
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 71%, ENSRNOG00000014287: 73%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Gene Sequence DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Gene ID - Mouse ENSMUSG00000003068
Gene ID - Rat ENSRNOG00000014287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STK11 pAb (ATL-HPA067481)
Datasheet Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link)
Vendor Page Anti STK11 pAb (ATL-HPA067481) at Atlas Antibodies

Documents & Links for Anti STK11 pAb (ATL-HPA067481)
Datasheet Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link)
Vendor Page Anti STK11 pAb (ATL-HPA067481)

Product Description

Protein Description: serine/threonine kinase 11
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 71%, ENSRNOG00000014287: 73%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Gene Sequence DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Gene ID - Mouse ENSMUSG00000003068
Gene ID - Rat ENSRNOG00000014287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STK11 pAb (ATL-HPA067481)
Datasheet Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link)
Vendor Page Anti STK11 pAb (ATL-HPA067481) at Atlas Antibodies

Documents & Links for Anti STK11 pAb (ATL-HPA067481)
Datasheet Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link)
Vendor Page Anti STK11 pAb (ATL-HPA067481)