Protein Description: serine/threonine kinase 11
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 71%, ENSRNOG00000014287: 73%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 71%, ENSRNOG00000014287: 73%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR |
| Documents & Links for Anti STK11 pAb (ATL-HPA067481) | |
| Datasheet | Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link) |
| Vendor Page | Anti STK11 pAb (ATL-HPA067481) at Atlas |
| Documents & Links for Anti STK11 pAb (ATL-HPA067481) | |
| Datasheet | Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link) |
| Vendor Page | Anti STK11 pAb (ATL-HPA067481) |