Protein Description: STEAP family member 4
Gene Name: STEAP4
Alternative Gene Name: FLJ23153, STAMP2, TIARP, TNFAIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012428: 65%, ENSRNOG00000008602: 71%
Entrez Gene ID: 79689
Uniprot ID: Q687X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STEAP4
Alternative Gene Name: FLJ23153, STAMP2, TIARP, TNFAIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012428: 65%, ENSRNOG00000008602: 71%
Entrez Gene ID: 79689
Uniprot ID: Q687X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD |
| Documents & Links for Anti STEAP4 pAb (ATL-HPA075871) | |
| Datasheet | Anti STEAP4 pAb (ATL-HPA075871) Datasheet (External Link) |
| Vendor Page | Anti STEAP4 pAb (ATL-HPA075871) at Atlas |
| Documents & Links for Anti STEAP4 pAb (ATL-HPA075871) | |
| Datasheet | Anti STEAP4 pAb (ATL-HPA075871) Datasheet (External Link) |
| Vendor Page | Anti STEAP4 pAb (ATL-HPA075871) |