Anti STEAP4 pAb (ATL-HPA065201)

Catalog No:
ATL-HPA065201-25
$447.00

Description

Product Description

Protein Description: STEAP4 metalloreductase
Gene Name: STEAP4
Alternative Gene Name: FLJ23153, SchLAH, STAMP2, TIARP, TNFAIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012428: 78%, ENSRNOG00000008602: 77%
Entrez Gene ID: 79689
Uniprot ID: Q687X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHY
Gene Sequence TCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHY
Gene ID - Mouse ENSMUSG00000012428
Gene ID - Rat ENSRNOG00000008602
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STEAP4 pAb (ATL-HPA065201)
Datasheet Anti STEAP4 pAb (ATL-HPA065201) Datasheet (External Link)
Vendor Page Anti STEAP4 pAb (ATL-HPA065201) at Atlas Antibodies

Documents & Links for Anti STEAP4 pAb (ATL-HPA065201)
Datasheet Anti STEAP4 pAb (ATL-HPA065201) Datasheet (External Link)
Vendor Page Anti STEAP4 pAb (ATL-HPA065201)

Product Description

Protein Description: STEAP4 metalloreductase
Gene Name: STEAP4
Alternative Gene Name: FLJ23153, SchLAH, STAMP2, TIARP, TNFAIP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012428: 78%, ENSRNOG00000008602: 77%
Entrez Gene ID: 79689
Uniprot ID: Q687X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHY
Gene Sequence TCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHY
Gene ID - Mouse ENSMUSG00000012428
Gene ID - Rat ENSRNOG00000008602
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STEAP4 pAb (ATL-HPA065201)
Datasheet Anti STEAP4 pAb (ATL-HPA065201) Datasheet (External Link)
Vendor Page Anti STEAP4 pAb (ATL-HPA065201) at Atlas Antibodies

Documents & Links for Anti STEAP4 pAb (ATL-HPA065201)
Datasheet Anti STEAP4 pAb (ATL-HPA065201) Datasheet (External Link)
Vendor Page Anti STEAP4 pAb (ATL-HPA065201)