Anti STAU1 pAb (ATL-HPA072004)

Catalog No:
ATL-HPA072004-25
$395.00

Description

Product Description

Protein Description: staufen double-stranded RNA binding protein 1
Gene Name: STAU1
Alternative Gene Name: PPP1R150, STAU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039536: 76%, ENSRNOG00000007781: 76%
Entrez Gene ID: 6780
Uniprot ID: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA
Gene Sequence ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA
Gene ID - Mouse ENSMUSG00000039536
Gene ID - Rat ENSRNOG00000007781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STAU1 pAb (ATL-HPA072004)
Datasheet Anti STAU1 pAb (ATL-HPA072004) Datasheet (External Link)
Vendor Page Anti STAU1 pAb (ATL-HPA072004) at Atlas Antibodies

Documents & Links for Anti STAU1 pAb (ATL-HPA072004)
Datasheet Anti STAU1 pAb (ATL-HPA072004) Datasheet (External Link)
Vendor Page Anti STAU1 pAb (ATL-HPA072004)

Product Description

Protein Description: staufen double-stranded RNA binding protein 1
Gene Name: STAU1
Alternative Gene Name: PPP1R150, STAU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039536: 76%, ENSRNOG00000007781: 76%
Entrez Gene ID: 6780
Uniprot ID: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA
Gene Sequence ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA
Gene ID - Mouse ENSMUSG00000039536
Gene ID - Rat ENSRNOG00000007781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STAU1 pAb (ATL-HPA072004)
Datasheet Anti STAU1 pAb (ATL-HPA072004) Datasheet (External Link)
Vendor Page Anti STAU1 pAb (ATL-HPA072004) at Atlas Antibodies

Documents & Links for Anti STAU1 pAb (ATL-HPA072004)
Datasheet Anti STAU1 pAb (ATL-HPA072004) Datasheet (External Link)
Vendor Page Anti STAU1 pAb (ATL-HPA072004)