Description
Product Description
Protein Description: staufen double-stranded RNA binding protein 1
Gene Name: STAU1
Alternative Gene Name: PPP1R150, STAU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039536: 76%, ENSRNOG00000007781: 76%
Entrez Gene ID: 6780
Uniprot ID: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STAU1
Alternative Gene Name: PPP1R150, STAU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039536: 76%, ENSRNOG00000007781: 76%
Entrez Gene ID: 6780
Uniprot ID: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA |
Gene Sequence | ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA |
Gene ID - Mouse | ENSMUSG00000039536 |
Gene ID - Rat | ENSRNOG00000007781 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti STAU1 pAb (ATL-HPA072004) | |
Datasheet | Anti STAU1 pAb (ATL-HPA072004) Datasheet (External Link) |
Vendor Page | Anti STAU1 pAb (ATL-HPA072004) at Atlas Antibodies |
Documents & Links for Anti STAU1 pAb (ATL-HPA072004) | |
Datasheet | Anti STAU1 pAb (ATL-HPA072004) Datasheet (External Link) |
Vendor Page | Anti STAU1 pAb (ATL-HPA072004) |