Protein Description: StAR-related lipid transfer (START) domain containing 7
Gene Name: STARD7
Alternative Gene Name: GTT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027367: 97%, ENSRNOG00000013479: 95%
Entrez Gene ID: 56910
Uniprot ID: Q9NQZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STARD7
Alternative Gene Name: GTT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027367: 97%, ENSRNOG00000013479: 95%
Entrez Gene ID: 56910
Uniprot ID: Q9NQZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE |
Documents & Links for Anti STARD7 pAb (ATL-HPA064958) | |
Datasheet | Anti STARD7 pAb (ATL-HPA064958) Datasheet (External Link) |
Vendor Page | Anti STARD7 pAb (ATL-HPA064958) at Atlas |
Documents & Links for Anti STARD7 pAb (ATL-HPA064958) | |
Datasheet | Anti STARD7 pAb (ATL-HPA064958) Datasheet (External Link) |
Vendor Page | Anti STARD7 pAb (ATL-HPA064958) |