Anti STARD7 pAb (ATL-HPA064958)

Catalog No:
ATL-HPA064958-25
$303.00

Description

Product Description

Protein Description: StAR-related lipid transfer (START) domain containing 7
Gene Name: STARD7
Alternative Gene Name: GTT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027367: 97%, ENSRNOG00000013479: 95%
Entrez Gene ID: 56910
Uniprot ID: Q9NQZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE
Gene Sequence VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE
Gene ID - Mouse ENSMUSG00000027367
Gene ID - Rat ENSRNOG00000013479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STARD7 pAb (ATL-HPA064958)
Datasheet Anti STARD7 pAb (ATL-HPA064958) Datasheet (External Link)
Vendor Page Anti STARD7 pAb (ATL-HPA064958) at Atlas Antibodies

Documents & Links for Anti STARD7 pAb (ATL-HPA064958)
Datasheet Anti STARD7 pAb (ATL-HPA064958) Datasheet (External Link)
Vendor Page Anti STARD7 pAb (ATL-HPA064958)

Product Description

Protein Description: StAR-related lipid transfer (START) domain containing 7
Gene Name: STARD7
Alternative Gene Name: GTT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027367: 97%, ENSRNOG00000013479: 95%
Entrez Gene ID: 56910
Uniprot ID: Q9NQZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE
Gene Sequence VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE
Gene ID - Mouse ENSMUSG00000027367
Gene ID - Rat ENSRNOG00000013479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti STARD7 pAb (ATL-HPA064958)
Datasheet Anti STARD7 pAb (ATL-HPA064958) Datasheet (External Link)
Vendor Page Anti STARD7 pAb (ATL-HPA064958) at Atlas Antibodies

Documents & Links for Anti STARD7 pAb (ATL-HPA064958)
Datasheet Anti STARD7 pAb (ATL-HPA064958) Datasheet (External Link)
Vendor Page Anti STARD7 pAb (ATL-HPA064958)