Anti STARD3 pAb (ATL-HPA073948)

Atlas Antibodies

Catalog No: ATL-HPA073948-25

• 
• 

Product Description

Protein Description: StAR related lipid transfer domain containing 3
Gene Name: STARD3
Alternative Gene Name: es64, MLN64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018167: 97%, ENSRNOG00000042044: 97%
Entrez Gene ID: 10948
Uniprot ID: Q14849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNK
• Gene Sequence: EVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNK
• Gene ID - Mouse: ENSMUSG00000018167
• Gene ID - Rat: ENSRNOG00000042044
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.