![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101214/181285/atl-hpa073948_anti-stard3-pab-atl-hpa073948_62953__50895.1681137577.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: StAR related lipid transfer domain containing 3
Gene Name: STARD3
Alternative Gene Name: es64, MLN64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018167: 97%, ENSRNOG00000042044: 97%
Entrez Gene ID: 10948
Uniprot ID: Q14849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STARD3
Alternative Gene Name: es64, MLN64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018167: 97%, ENSRNOG00000042044: 97%
Entrez Gene ID: 10948
Uniprot ID: Q14849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNK |
| Documents & Links for Anti STARD3 pAb (ATL-HPA073948) | |
| Datasheet | Anti STARD3 pAb (ATL-HPA073948) Datasheet (External Link) |
| Vendor Page | Anti STARD3 pAb (ATL-HPA073948) at Atlas |
| Documents & Links for Anti STARD3 pAb (ATL-HPA073948) | |
| Datasheet | Anti STARD3 pAb (ATL-HPA073948) Datasheet (External Link) |
| Vendor Page | Anti STARD3 pAb (ATL-HPA073948) |