Anti STARD13 pAb (ATL-HPA058867 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA058867-25

• 

Product Description

Protein Description: StAR-related lipid transfer (START) domain containing 13
Gene Name: STARD13
Alternative Gene Name: ARHGAP37, DLC2, GT650, LINC00464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016128: 87%, ENSRNOG00000001090: 85%
Entrez Gene ID: 90627
Uniprot ID: Q9Y3M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCC
• Gene Sequence: DSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCC
• Gene ID - Mouse: ENSMUSG00000016128
• Gene ID - Rat: ENSRNOG00000001090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.