Description
Product Description
Protein Description: StAR-related lipid transfer (START) domain containing 13
Gene Name: STARD13
Alternative Gene Name: ARHGAP37, DLC2, GT650, LINC00464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016128: 87%, ENSRNOG00000001090: 85%
Entrez Gene ID: 90627
Uniprot ID: Q9Y3M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STARD13
Alternative Gene Name: ARHGAP37, DLC2, GT650, LINC00464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016128: 87%, ENSRNOG00000001090: 85%
Entrez Gene ID: 90627
Uniprot ID: Q9Y3M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCC |
Gene Sequence | DSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCC |
Gene ID - Mouse | ENSMUSG00000016128 |
Gene ID - Rat | ENSRNOG00000001090 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti STARD13 pAb (ATL-HPA058867 w/enhanced validation) | |
Datasheet | Anti STARD13 pAb (ATL-HPA058867 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti STARD13 pAb (ATL-HPA058867 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti STARD13 pAb (ATL-HPA058867 w/enhanced validation) | |
Datasheet | Anti STARD13 pAb (ATL-HPA058867 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti STARD13 pAb (ATL-HPA058867 w/enhanced validation) |