Protein Description: SH3 and cysteine rich domain 2
Gene Name: STAC2
Alternative Gene Name: 24b2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017400: 97%, ENSRNOG00000004805: 99%
Entrez Gene ID: 342667
Uniprot ID: Q6ZMT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STAC2
Alternative Gene Name: 24b2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017400: 97%, ENSRNOG00000004805: 99%
Entrez Gene ID: 342667
Uniprot ID: Q6ZMT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEP |
| Documents & Links for Anti STAC2 pAb (ATL-HPA076925) | |
| Datasheet | Anti STAC2 pAb (ATL-HPA076925) Datasheet (External Link) |
| Vendor Page | Anti STAC2 pAb (ATL-HPA076925) at Atlas |
| Documents & Links for Anti STAC2 pAb (ATL-HPA076925) | |
| Datasheet | Anti STAC2 pAb (ATL-HPA076925) Datasheet (External Link) |
| Vendor Page | Anti STAC2 pAb (ATL-HPA076925) |