Protein Description: stabilin 2
Gene Name: STAB2
Alternative Gene Name: DKFZP434E0321, FEEL-2, FELL, HARE, SCARH1, STAB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035459: 81%, ENSRNOG00000038948: 80%
Entrez Gene ID: 55576
Uniprot ID: Q8WWQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: STAB2
Alternative Gene Name: DKFZP434E0321, FEEL-2, FELL, HARE, SCARH1, STAB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035459: 81%, ENSRNOG00000038948: 80%
Entrez Gene ID: 55576
Uniprot ID: Q8WWQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KGYVGDGLTCYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLH |
| Documents & Links for Anti STAB2 pAb (ATL-HPA072699 w/enhanced validation) | |
| Datasheet | Anti STAB2 pAb (ATL-HPA072699 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STAB2 pAb (ATL-HPA072699 w/enhanced validation) at Atlas |
| Documents & Links for Anti STAB2 pAb (ATL-HPA072699 w/enhanced validation) | |
| Datasheet | Anti STAB2 pAb (ATL-HPA072699 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti STAB2 pAb (ATL-HPA072699 w/enhanced validation) |