Protein Description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3
Gene Name: ST8SIA3
Alternative Gene Name: SIAT8C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056812: 100%, ENSRNOG00000018305: 100%
Entrez Gene ID: 51046
Uniprot ID: O43173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ST8SIA3
Alternative Gene Name: SIAT8C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056812: 100%, ENSRNOG00000018305: 100%
Entrez Gene ID: 51046
Uniprot ID: O43173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA |
| Documents & Links for Anti ST8SIA3 pAb (ATL-HPA066783) | |
| Datasheet | Anti ST8SIA3 pAb (ATL-HPA066783) Datasheet (External Link) |
| Vendor Page | Anti ST8SIA3 pAb (ATL-HPA066783) at Atlas |
| Documents & Links for Anti ST8SIA3 pAb (ATL-HPA066783) | |
| Datasheet | Anti ST8SIA3 pAb (ATL-HPA066783) Datasheet (External Link) |
| Vendor Page | Anti ST8SIA3 pAb (ATL-HPA066783) |