Anti ST8SIA2 pAb (ATL-HPA057819)

Atlas Antibodies

Catalog No: ATL-HPA057819-25

• 

Product Description

Protein Description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Gene Name: ST8SIA2
Alternative Gene Name: HsT19690, SIAT8B, ST8SIA-II, STX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025789: 96%, ENSRNOG00000022791: 28%
Entrez Gene ID: 8128
Uniprot ID: Q92186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI
• Gene Sequence: EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI
• Gene ID - Mouse: ENSMUSG00000025789
• Gene ID - Rat: ENSRNOG00000022791
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.