Description
Product Description
Protein Description: ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Name: ST3GAL5
Alternative Gene Name: SIAT9, SIATGM3S, ST3GalV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056091: 93%, ENSRNOG00000010284: 94%
Entrez Gene ID: 8869
Uniprot ID: Q9UNP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ST3GAL5
Alternative Gene Name: SIAT9, SIATGM3S, ST3GalV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056091: 93%, ENSRNOG00000010284: 94%
Entrez Gene ID: 8869
Uniprot ID: Q9UNP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG |
Gene Sequence | NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG |
Gene ID - Mouse | ENSMUSG00000056091 |
Gene ID - Rat | ENSRNOG00000010284 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ST3GAL5 pAb (ATL-HPA068928) | |
Datasheet | Anti ST3GAL5 pAb (ATL-HPA068928) Datasheet (External Link) |
Vendor Page | Anti ST3GAL5 pAb (ATL-HPA068928) at Atlas Antibodies |
Documents & Links for Anti ST3GAL5 pAb (ATL-HPA068928) | |
Datasheet | Anti ST3GAL5 pAb (ATL-HPA068928) Datasheet (External Link) |
Vendor Page | Anti ST3GAL5 pAb (ATL-HPA068928) |