Anti SST pAb (ATL-HPA019472 w/enhanced validation)

Catalog No:
ATL-HPA019472-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: somatostatin
Gene Name: SST
Alternative Gene Name: SMST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004366: 98%, ENSRNOG00000001837: 98%
Entrez Gene ID: 6750
Uniprot ID: P61278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN
Gene Sequence APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN
Gene ID - Mouse ENSMUSG00000004366
Gene ID - Rat ENSRNOG00000001837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SST pAb (ATL-HPA019472 w/enhanced validation)
Datasheet Anti SST pAb (ATL-HPA019472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SST pAb (ATL-HPA019472 w/enhanced validation) at Atlas

Documents & Links for Anti SST pAb (ATL-HPA019472 w/enhanced validation)
Datasheet Anti SST pAb (ATL-HPA019472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SST pAb (ATL-HPA019472 w/enhanced validation)

Citations for Anti SST pAb (ATL-HPA019472 w/enhanced validation) – 4 Found
Senft, Rebecca A; Freret, Morgan E; Sturrock, Nikita; Dymecki, Susan M. Neurochemically and Hodologically Distinct Ascending VGLUT3 versus Serotonin Subsystems Comprise the r2-Pet1 Median Raphe. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2021;41(12):2581-2600.  PubMed
Krawchuk, Michael B; Ruff, Catherine F; Yang, Xiaoling; Ross, Sarah E; Vazquez, Alberto L. Optogenetic assessment of VIP, PV, SOM and NOS inhibitory neuron activity and cerebral blood flow regulation in mouse somato-sensory cortex. Journal Of Cerebral Blood Flow And Metabolism : Official Journal Of The International Society Of Cerebral Blood Flow And Metabolism. 2020;40(7):1427-1440.  PubMed
Ibrahim, Muna; MacFarlane, Erin M; Matteo, Geronimo; Hoyeck, Myriam P; Rick, Kayleigh R C; Farokhi, Salar; Copley, Catherine M; O'Dwyer, Shannon; Bruin, Jennifer E. Functional cytochrome P450 1A enzymes are induced in mouse and human islets following pollutant exposure. Diabetologia. 2020;63(1):162-178.  PubMed
Hoyeck, Myriam P; Blair, Hannah; Ibrahim, Muna; Solanki, Shivani; Elsawy, Mariam; Prakash, Arina; Rick, Kayleigh R C; Matteo, Geronimo; O'Dwyer, Shannon; Bruin, Jennifer E. Long-term metabolic consequences of acute dioxin exposure differ between male and female mice. Scientific Reports. 2020;10(1):1448.  PubMed