Anti SSSCA1 pAb (ATL-HPA064670)

Atlas Antibodies

Catalog No: ATL-HPA064670-25

• 

Product Description

Protein Description: Sjogren syndrome/scleroderma autoantigen 1
Gene Name: SSSCA1
Alternative Gene Name: p27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079478: 86%, ENSRNOG00000012736: 86%
Entrez Gene ID: 10534
Uniprot ID: O60232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH
• Gene Sequence: VMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH
• Gene ID - Mouse: ENSMUSG00000079478
• Gene ID - Rat: ENSRNOG00000012736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.