Protein Description: Sjogren syndrome/scleroderma autoantigen 1
Gene Name: SSSCA1
Alternative Gene Name: p27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079478: 86%, ENSRNOG00000012736: 86%
Entrez Gene ID: 10534
Uniprot ID: O60232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SSSCA1
Alternative Gene Name: p27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079478: 86%, ENSRNOG00000012736: 86%
Entrez Gene ID: 10534
Uniprot ID: O60232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH |
| Documents & Links for Anti SSSCA1 pAb (ATL-HPA064670) | |
| Datasheet | Anti SSSCA1 pAb (ATL-HPA064670) Datasheet (External Link) |
| Vendor Page | Anti SSSCA1 pAb (ATL-HPA064670) at Atlas |
| Documents & Links for Anti SSSCA1 pAb (ATL-HPA064670) | |
| Datasheet | Anti SSSCA1 pAb (ATL-HPA064670) Datasheet (External Link) |
| Vendor Page | Anti SSSCA1 pAb (ATL-HPA064670) |