Description
Product Description
Protein Description: scavenger receptor cysteine rich family, 4 domains
Gene Name: SSC4D
Alternative Gene Name: S4D-SRCRB, SRCRB-S4D, SRCRB4D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029699: 94%, ENSRNOG00000001435: 92%
Entrez Gene ID: 136853
Uniprot ID: Q8WTU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SSC4D
Alternative Gene Name: S4D-SRCRB, SRCRB-S4D, SRCRB4D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029699: 94%, ENSRNOG00000001435: 92%
Entrez Gene ID: 136853
Uniprot ID: Q8WTU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP |
| Gene Sequence | PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP |
| Gene ID - Mouse | ENSMUSG00000029699 |
| Gene ID - Rat | ENSRNOG00000001435 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SSC4D pAb (ATL-HPA062611) | |
| Datasheet | Anti SSC4D pAb (ATL-HPA062611) Datasheet (External Link) |
| Vendor Page | Anti SSC4D pAb (ATL-HPA062611) at Atlas Antibodies |
| Documents & Links for Anti SSC4D pAb (ATL-HPA062611) | |
| Datasheet | Anti SSC4D pAb (ATL-HPA062611) Datasheet (External Link) |
| Vendor Page | Anti SSC4D pAb (ATL-HPA062611) |