Protein Description: single stranded DNA binding protein 2
Gene Name: SSBP2
Alternative Gene Name: HSPC116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003992: 76%, ENSRNOG00000016213: 76%
Entrez Gene ID: 23635
Uniprot ID: P81877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SSBP2
Alternative Gene Name: HSPC116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003992: 76%, ENSRNOG00000016213: 76%
Entrez Gene ID: 23635
Uniprot ID: P81877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LGPQSDPWLSLQNYGGAMRPPLNALGGPGMPGMNMGPGGGR |
Documents & Links for Anti SSBP2 pAb (ATL-HPA068605) | |
Datasheet | Anti SSBP2 pAb (ATL-HPA068605) Datasheet (External Link) |
Vendor Page | Anti SSBP2 pAb (ATL-HPA068605) at Atlas |
Documents & Links for Anti SSBP2 pAb (ATL-HPA068605) | |
Datasheet | Anti SSBP2 pAb (ATL-HPA068605) Datasheet (External Link) |
Vendor Page | Anti SSBP2 pAb (ATL-HPA068605) |