Description
Product Description
Protein Description: synovial sarcoma translocation, chromosome 18
Gene Name: SS18
Alternative Gene Name: SSXT, SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037013: 96%, ENSRNOG00000016800: 96%
Entrez Gene ID: 6760
Uniprot ID: Q15532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SS18
Alternative Gene Name: SSXT, SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037013: 96%, ENSRNOG00000016800: 96%
Entrez Gene ID: 6760
Uniprot ID: Q15532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMP |
Gene Sequence | NGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMP |
Gene ID - Mouse | ENSMUSG00000037013 |
Gene ID - Rat | ENSRNOG00000016800 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SS18 pAb (ATL-HPA059539) | |
Datasheet | Anti SS18 pAb (ATL-HPA059539) Datasheet (External Link) |
Vendor Page | Anti SS18 pAb (ATL-HPA059539) at Atlas Antibodies |
Documents & Links for Anti SS18 pAb (ATL-HPA059539) | |
Datasheet | Anti SS18 pAb (ATL-HPA059539) Datasheet (External Link) |
Vendor Page | Anti SS18 pAb (ATL-HPA059539) |