Anti SRRT pAb (ATL-HPA058379)

Atlas Antibodies

Catalog No: ATL-HPA058379-100

• 
• 

Product Description

Protein Description: serrate, RNA effector molecule
Gene Name: SRRT
Alternative Gene Name: ARS2, Asr2, serrate
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037364: 100%, ENSRNOG00000048277: 92%
Entrez Gene ID: 51593
Uniprot ID: Q9BXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF
• Gene Sequence: GLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF
• Gene ID - Mouse: ENSMUSG00000037364
• Gene ID - Rat: ENSRNOG00000048277
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.