Protein Description: sorcin
Gene Name: SRI
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003161: 93%, ENSRNOG00000049780: 92%
Entrez Gene ID: 6717
Uniprot ID: P30626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SRI
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003161: 93%, ENSRNOG00000049780: 92%
Entrez Gene ID: 6717
Uniprot ID: P30626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYI |
Documents & Links for Anti SRI pAb (ATL-HPA073666 w/enhanced validation) | |
Datasheet | Anti SRI pAb (ATL-HPA073666 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SRI pAb (ATL-HPA073666 w/enhanced validation) at Atlas |
Documents & Links for Anti SRI pAb (ATL-HPA073666 w/enhanced validation) | |
Datasheet | Anti SRI pAb (ATL-HPA073666 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SRI pAb (ATL-HPA073666 w/enhanced validation) |