Anti SRCIN1 pAb (ATL-HPA063795 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA063795-25

• 
• 

Product Description

Protein Description: SRC kinase signaling inhibitor 1
Gene Name: SRCIN1
Alternative Gene Name: KIAA1684, p140Cap, SNIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038453: 81%, ENSRNOG00000011475: 85%
Entrez Gene ID: 80725
Uniprot ID: Q9C0H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKRSVDKAVSVEAAERDWE
• Gene Sequence: EGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKRSVDKAVSVEAAERDWE
• Gene ID - Mouse: ENSMUSG00000038453
• Gene ID - Rat: ENSRNOG00000011475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.