Protein Description: SRC kinase signaling inhibitor 1
Gene Name: SRCIN1
Alternative Gene Name: KIAA1684, p140Cap, SNIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038453: 81%, ENSRNOG00000011475: 85%
Entrez Gene ID: 80725
Uniprot ID: Q9C0H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SRCIN1
Alternative Gene Name: KIAA1684, p140Cap, SNIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038453: 81%, ENSRNOG00000011475: 85%
Entrez Gene ID: 80725
Uniprot ID: Q9C0H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKRSVDKAVSVEAAERDWE |
Documents & Links for Anti SRCIN1 pAb (ATL-HPA063795 w/enhanced validation) | |
Datasheet | Anti SRCIN1 pAb (ATL-HPA063795 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SRCIN1 pAb (ATL-HPA063795 w/enhanced validation) at Atlas |
Documents & Links for Anti SRCIN1 pAb (ATL-HPA063795 w/enhanced validation) | |
Datasheet | Anti SRCIN1 pAb (ATL-HPA063795 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SRCIN1 pAb (ATL-HPA063795 w/enhanced validation) |