Protein Description: SRC proto-oncogene, non-receptor tyrosine kinase
Gene Name: SRC
Alternative Gene Name: ASV, c-src, SRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027646: 95%, ENSRNOG00000009495: 98%
Entrez Gene ID: 6714
Uniprot ID: P12931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SRC
Alternative Gene Name: ASV, c-src, SRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027646: 95%, ENSRNOG00000009495: 98%
Entrez Gene ID: 6714
Uniprot ID: P12931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS |
| Gene Sequence | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS |
| Gene ID - Mouse | ENSMUSG00000027646 |
| Gene ID - Rat | ENSRNOG00000009495 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRC pAb (ATL-HPA030875 w/enhanced validation) | |
| Datasheet | Anti SRC pAb (ATL-HPA030875 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SRC pAb (ATL-HPA030875 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SRC pAb (ATL-HPA030875 w/enhanced validation) | |
| Datasheet | Anti SRC pAb (ATL-HPA030875 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SRC pAb (ATL-HPA030875 w/enhanced validation) |