Protein Description: S1 RNA binding domain 1
Gene Name: SRBD1
Alternative Gene Name: FLJ10379
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024135: 72%, ENSRNOG00000014720: 71%
Entrez Gene ID: 55133
Uniprot ID: Q8N5C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SRBD1
Alternative Gene Name: FLJ10379
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024135: 72%, ENSRNOG00000014720: 71%
Entrez Gene ID: 55133
Uniprot ID: Q8N5C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VWGGTCKKEENDDDFTFGQSALKKIKTETYPQGQPVKFPANANSTKEEVEMNWDMVQVLSERTNIEPWVCANIIRLFNDDNTIPF |
| Gene Sequence | VWGGTCKKEENDDDFTFGQSALKKIKTETYPQGQPVKFPANANSTKEEVEMNWDMVQVLSERTNIEPWVCANIIRLFNDDNTIPF |
| Gene ID - Mouse | ENSMUSG00000024135 |
| Gene ID - Rat | ENSRNOG00000014720 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRBD1 pAb (ATL-HPA030568) | |
| Datasheet | Anti SRBD1 pAb (ATL-HPA030568) Datasheet (External Link) |
| Vendor Page | Anti SRBD1 pAb (ATL-HPA030568) at Atlas |
| Documents & Links for Anti SRBD1 pAb (ATL-HPA030568) | |
| Datasheet | Anti SRBD1 pAb (ATL-HPA030568) Datasheet (External Link) |
| Vendor Page | Anti SRBD1 pAb (ATL-HPA030568) |