Description
Product Description
Protein Description: sequestosome 1
Gene Name: SQSTM1
Alternative Gene Name: A170, OSIL, p60, p62, p62B, PDB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015837: 100%, ENSRNOG00000003147: 100%
Entrez Gene ID: 8878
Uniprot ID: Q13501
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SQSTM1
Alternative Gene Name: A170, OSIL, p60, p62, p62B, PDB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015837: 100%, ENSRNOG00000003147: 100%
Entrez Gene ID: 8878
Uniprot ID: Q13501
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH |
Gene Sequence | GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH |
Gene ID - Mouse | ENSMUSG00000015837 |
Gene ID - Rat | ENSRNOG00000003147 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SQSTM1 pAb (ATL-HPA064165) | |
Datasheet | Anti SQSTM1 pAb (ATL-HPA064165) Datasheet (External Link) |
Vendor Page | Anti SQSTM1 pAb (ATL-HPA064165) at Atlas Antibodies |
Documents & Links for Anti SQSTM1 pAb (ATL-HPA064165) | |
Datasheet | Anti SQSTM1 pAb (ATL-HPA064165) Datasheet (External Link) |
Vendor Page | Anti SQSTM1 pAb (ATL-HPA064165) |