Description
Product Description
Protein Description: serine palmitoyltransferase, long chain base subunit 1
Gene Name: SPTLC1
Alternative Gene Name: hLCB1, HSAN1, HSN1, LCB1, SPTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021468: 88%, ENSRNOG00000010882: 86%
Entrez Gene ID: 10558
Uniprot ID: O15269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPTLC1
Alternative Gene Name: hLCB1, HSAN1, HSN1, LCB1, SPTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021468: 88%, ENSRNOG00000010882: 86%
Entrez Gene ID: 10558
Uniprot ID: O15269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE |
Gene Sequence | GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE |
Gene ID - Mouse | ENSMUSG00000021468 |
Gene ID - Rat | ENSRNOG00000010882 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) | |
Datasheet | Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) | |
Datasheet | Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) |