Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation)

Catalog No:
ATL-HPA063907-25
$303.00

Description

Product Description

Protein Description: serine palmitoyltransferase, long chain base subunit 1
Gene Name: SPTLC1
Alternative Gene Name: hLCB1, HSAN1, HSN1, LCB1, SPTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021468: 88%, ENSRNOG00000010882: 86%
Entrez Gene ID: 10558
Uniprot ID: O15269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
Gene Sequence GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
Gene ID - Mouse ENSMUSG00000021468
Gene ID - Rat ENSRNOG00000010882
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation)
Datasheet Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation)

Product Description

Protein Description: serine palmitoyltransferase, long chain base subunit 1
Gene Name: SPTLC1
Alternative Gene Name: hLCB1, HSAN1, HSN1, LCB1, SPTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021468: 88%, ENSRNOG00000010882: 86%
Entrez Gene ID: 10558
Uniprot ID: O15269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
Gene Sequence GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
Gene ID - Mouse ENSMUSG00000021468
Gene ID - Rat ENSRNOG00000010882
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation)
Datasheet Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation)