Protein Description: sprouty RTK signaling antagonist 4
Gene Name: SPRY4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024427: 91%, ENSRNOG00000013851: 91%
Entrez Gene ID: 81848
Uniprot ID: Q9C004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPRY4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024427: 91%, ENSRNOG00000013851: 91%
Entrez Gene ID: 81848
Uniprot ID: Q9C004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACG |
| Documents & Links for Anti SPRY4 pAb (ATL-HPA072661) | |
| Datasheet | Anti SPRY4 pAb (ATL-HPA072661) Datasheet (External Link) |
| Vendor Page | Anti SPRY4 pAb (ATL-HPA072661) at Atlas |
| Documents & Links for Anti SPRY4 pAb (ATL-HPA072661) | |
| Datasheet | Anti SPRY4 pAb (ATL-HPA072661) Datasheet (External Link) |
| Vendor Page | Anti SPRY4 pAb (ATL-HPA072661) |