Anti SPRY1 pAb (ATL-HPA070554)

Atlas Antibodies

Catalog No: ATL-HPA070554-25

• 
• 

Product Description

Protein Description: sprouty RTK signaling antagonist 1
Gene Name: SPRY1
Alternative Gene Name: hSPRY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037211: 86%, ENSRNOG00000025371: 88%
Entrez Gene ID: 10252
Uniprot ID: O43609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC
• Gene Sequence: PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC
• Gene ID - Mouse: ENSMUSG00000037211
• Gene ID - Rat: ENSRNOG00000025371
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.