Protein Description: sprouty related EVH1 domain containing 2
Gene Name: SPRED2
Alternative Gene Name: FLJ21897, FLJ31917, Spred-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045671: 83%, ENSRNOG00000004888: 84%
Entrez Gene ID: 200734
Uniprot ID: Q7Z698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPRED2
Alternative Gene Name: FLJ21897, FLJ31917, Spred-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045671: 83%, ENSRNOG00000004888: 84%
Entrez Gene ID: 200734
Uniprot ID: Q7Z698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP |
Documents & Links for Anti SPRED2 pAb (ATL-HPA064394) | |
Datasheet | Anti SPRED2 pAb (ATL-HPA064394) Datasheet (External Link) |
Vendor Page | Anti SPRED2 pAb (ATL-HPA064394) at Atlas |
Documents & Links for Anti SPRED2 pAb (ATL-HPA064394) | |
Datasheet | Anti SPRED2 pAb (ATL-HPA064394) Datasheet (External Link) |
Vendor Page | Anti SPRED2 pAb (ATL-HPA064394) |