Anti SPRED2 pAb (ATL-HPA064394)

Atlas Antibodies

Catalog No: ATL-HPA064394-25

• 

Product Description

Protein Description: sprouty related EVH1 domain containing 2
Gene Name: SPRED2
Alternative Gene Name: FLJ21897, FLJ31917, Spred-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045671: 83%, ENSRNOG00000004888: 84%
Entrez Gene ID: 200734
Uniprot ID: Q7Z698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP
• Gene Sequence: EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP
• Gene ID - Mouse: ENSMUSG00000045671
• Gene ID - Rat: ENSRNOG00000004888
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.