Description
Product Description
Protein Description: signal peptide peptidase like 2A
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ |
Gene Sequence | KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ |
Gene ID - Mouse | ENSMUSG00000027366 |
Gene ID - Rat | ENSRNOG00000011652 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SPPL2A pAb (ATL-HPA067304) | |
Datasheet | Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link) |
Vendor Page | Anti SPPL2A pAb (ATL-HPA067304) at Atlas Antibodies |
Documents & Links for Anti SPPL2A pAb (ATL-HPA067304) | |
Datasheet | Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link) |
Vendor Page | Anti SPPL2A pAb (ATL-HPA067304) |