Protein Description: signal peptide peptidase like 2A
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ |
| Documents & Links for Anti SPPL2A pAb (ATL-HPA067304) | |
| Datasheet | Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link) |
| Vendor Page | Anti SPPL2A pAb (ATL-HPA067304) at Atlas |
| Documents & Links for Anti SPPL2A pAb (ATL-HPA067304) | |
| Datasheet | Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link) |
| Vendor Page | Anti SPPL2A pAb (ATL-HPA067304) |