Anti SPPL2A pAb (ATL-HPA067304)

Catalog No:
ATL-HPA067304-25
$447.00

Description

Product Description

Protein Description: signal peptide peptidase like 2A
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Gene Sequence KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Gene ID - Mouse ENSMUSG00000027366
Gene ID - Rat ENSRNOG00000011652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SPPL2A pAb (ATL-HPA067304)
Datasheet Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link)
Vendor Page Anti SPPL2A pAb (ATL-HPA067304) at Atlas Antibodies

Documents & Links for Anti SPPL2A pAb (ATL-HPA067304)
Datasheet Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link)
Vendor Page Anti SPPL2A pAb (ATL-HPA067304)

Product Description

Protein Description: signal peptide peptidase like 2A
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Gene Sequence KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Gene ID - Mouse ENSMUSG00000027366
Gene ID - Rat ENSRNOG00000011652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SPPL2A pAb (ATL-HPA067304)
Datasheet Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link)
Vendor Page Anti SPPL2A pAb (ATL-HPA067304) at Atlas Antibodies

Documents & Links for Anti SPPL2A pAb (ATL-HPA067304)
Datasheet Anti SPPL2A pAb (ATL-HPA067304) Datasheet (External Link)
Vendor Page Anti SPPL2A pAb (ATL-HPA067304)