Protein Description: secreted phosphoprotein 1
Gene Name: SPP1
Alternative Gene Name: BNSP, BSPI, ETA-1, OPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029304: 56%, ENSRNOG00000043451: 53%
Entrez Gene ID: 6696
Uniprot ID: P10451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPP1
Alternative Gene Name: BNSP, BSPI, ETA-1, OPN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029304: 56%, ENSRNOG00000043451: 53%
Entrez Gene ID: 6696
Uniprot ID: P10451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT |
Documents & Links for Anti SPP1 pAb (ATL-HPA027541 w/enhanced validation) | |
Datasheet | Anti SPP1 pAb (ATL-HPA027541 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPP1 pAb (ATL-HPA027541 w/enhanced validation) at Atlas |
Documents & Links for Anti SPP1 pAb (ATL-HPA027541 w/enhanced validation) | |
Datasheet | Anti SPP1 pAb (ATL-HPA027541 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPP1 pAb (ATL-HPA027541 w/enhanced validation) |
Citations for Anti SPP1 pAb (ATL-HPA027541 w/enhanced validation) – 6 Found |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
Fu, Dah-Jiun; Wang, Lianghai; Chouairi, Fouad K; Rose, Ian M; Abetov, Danysh A; Miller, Andrew D; Yamulla, Robert J; Schimenti, John C; Flesken-Nikitin, Andrea; Nikitin, Alexander Yu. Gastric squamous-columnar junction contains a large pool of cancer-prone immature osteopontin responsive Lgr5(-)CD44(+) cells. Nature Communications. 2020;11(1):84. PubMed |
Chen, Xun; Zhang, Wentao; Zhang, Qian; Song, Tao; Yu, Zirui; Li, Zhong; Duan, Ning; Dang, Xiaoqian. NSM00158 Specifically Disrupts the CtBP2-p300 Interaction to Reverse CtBP2-Mediated Transrepression and Prevent the Occurrence of Nonunion. Molecules And Cells. 2020;43(6):517-529. PubMed |
Asakage, Masaki; Usui, Yoshihiko; Nezu, Naoya; Shimizu, Hiroyuki; Tsubota, Kinya; Umazume, Kazuhiko; Yamakawa, Naoyuki; Umezu, Tomohiro; Suwanai, Hirotsugu; Kuroda, Masahiko; Goto, Hiroshi. Comprehensive Gene Analysis of IgG4-Related Ophthalmic Disease Using RNA Sequencing. Journal Of Clinical Medicine. 2020;9(11) PubMed |
Pereira, Ana Rita; Lipphaus, Andreas; Ergin, Mert; Salehi, Sahar; Gehweiler, Dominic; Rudert, Maximilian; Hansmann, Jan; Herrmann, Marietta. Modeling of the Human Bone Environment: Mechanical Stimuli Guide Mesenchymal Stem Cell-Extracellular Matrix Interactions. Materials (Basel, Switzerland). 2021;14(16) PubMed |
Månberg, Anna; Skene, Nathan; Sanders, Folkert; Trusohamn, Marta; Remnestål, Julia; Szczepińska, Anna; Aksoylu, Inci Sevval; Lönnerberg, Peter; Ebarasi, Lwaki; Wouters, Stefan; Lehmann, Manuela; Olofsson, Jennie; von Gohren Antequera, Inti; Domaniku, Aylin; De Schaepdryver, Maxim; De Vocht, Joke; Poesen, Koen; Uhlén, Mathias; Anink, Jasper; Mijnsbergen, Caroline; Vergunst-Bosch, Hermieneke; Hübers, Annemarie; Kläppe, Ulf; Rodriguez-Vieitez, Elena; Gilthorpe, Jonathan D; Hedlund, Eva; Harris, Robert A; Aronica, Eleonora; Van Damme, Philip; Ludolph, Albert; Veldink, Jan; Ingre, Caroline; Nilsson, Peter; Lewandowski, Sebastian A. Altered perivascular fibroblast activity precedes ALS disease onset. Nature Medicine. 2021;27(4):640-646. PubMed |