Anti SPOUT1 pAb (ATL-HPA076946)

Atlas

Catalog No: ATL-HPA076946-25

• 
• 

Protein Description: SPOUT domain containing methyltransferase 1
Gene Name: SPOUT1
Alternative Gene Name: C9orf114, CENP-32, HSPC109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039660: 85%, ENSRNOG00000025711: 85%
Entrez Gene ID: 51490
Uniprot ID: Q5T280
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: CGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLS
• Gene ID - Mouse: ENSMUSG00000039660
• Gene ID - Rat: ENSMUSG00000039660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.