Description
Product Description
Protein Description: SPOUT domain containing methyltransferase 1
Gene Name: SPOUT1
Alternative Gene Name: C9orf114, CENP-32, HSPC109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039660: 85%, ENSRNOG00000025711: 85%
Entrez Gene ID: 51490
Uniprot ID: Q5T280
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPOUT1
Alternative Gene Name: C9orf114, CENP-32, HSPC109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039660: 85%, ENSRNOG00000025711: 85%
Entrez Gene ID: 51490
Uniprot ID: Q5T280
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLS |
Gene Sequence | CGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLS |
Gene ID - Mouse | ENSMUSG00000039660 |
Gene ID - Rat | ENSRNOG00000025711 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SPOUT1 pAb (ATL-HPA076946) | |
Datasheet | Anti SPOUT1 pAb (ATL-HPA076946) Datasheet (External Link) |
Vendor Page | Anti SPOUT1 pAb (ATL-HPA076946) at Atlas Antibodies |
Documents & Links for Anti SPOUT1 pAb (ATL-HPA076946) | |
Datasheet | Anti SPOUT1 pAb (ATL-HPA076946) Datasheet (External Link) |
Vendor Page | Anti SPOUT1 pAb (ATL-HPA076946) |