Anti SPON2 pAb (ATL-HPA066095)

Atlas Antibodies

Catalog No: ATL-HPA066095-25

• 
• 

Product Description

Protein Description: spondin 2, extracellular matrix protein
Gene Name: SPON2
Alternative Gene Name: DIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037379: 89%, ENSRNOG00000046246: 89%
Entrez Gene ID: 10417
Uniprot ID: Q9BUD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSP
• Gene Sequence: HSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSP
• Gene ID - Mouse: ENSMUSG00000037379
• Gene ID - Rat: ENSRNOG00000046246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.