Protein Description: spondin 1
Gene Name: SPON1
Alternative Gene Name: f-spondin, KIAA0762
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038156: 97%, ENSRNOG00000058003: 97%
Entrez Gene ID: 10418
Uniprot ID: Q9HCB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPON1
Alternative Gene Name: f-spondin, KIAA0762
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038156: 97%, ENSRNOG00000058003: 97%
Entrez Gene ID: 10418
Uniprot ID: Q9HCB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPV |
Documents & Links for Anti SPON1 pAb (ATL-HPA077546) | |
Datasheet | Anti SPON1 pAb (ATL-HPA077546) Datasheet (External Link) |
Vendor Page | Anti SPON1 pAb (ATL-HPA077546) at Atlas |
Documents & Links for Anti SPON1 pAb (ATL-HPA077546) | |
Datasheet | Anti SPON1 pAb (ATL-HPA077546) Datasheet (External Link) |
Vendor Page | Anti SPON1 pAb (ATL-HPA077546) |