Description
Product Description
Protein Description: spindlin family, member 2A
Gene Name: SPIN2A
Alternative Gene Name: DXF34, SPIN2, TDRD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021395: 53%, ENSRNOG00000011119: 53%
Entrez Gene ID: 54466
Uniprot ID: Q99865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPIN2A
Alternative Gene Name: DXF34, SPIN2, TDRD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021395: 53%, ENSRNOG00000011119: 53%
Entrez Gene ID: 54466
Uniprot ID: Q99865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ |
Gene Sequence | MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ |
Gene ID - Mouse | ENSMUSG00000021395 |
Gene ID - Rat | ENSRNOG00000011119 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SPIN2A pAb (ATL-HPA069835) | |
Datasheet | Anti SPIN2A pAb (ATL-HPA069835) Datasheet (External Link) |
Vendor Page | Anti SPIN2A pAb (ATL-HPA069835) at Atlas Antibodies |
Documents & Links for Anti SPIN2A pAb (ATL-HPA069835) | |
Datasheet | Anti SPIN2A pAb (ATL-HPA069835) Datasheet (External Link) |
Vendor Page | Anti SPIN2A pAb (ATL-HPA069835) |