Anti SPECC1L pAb (ATL-HPA070614)

Atlas Antibodies

Catalog No: ATL-HPA070614-25

• 
• 
• 

Product Description

Protein Description: sperm antigen with calponin homology and coiled-coil domains 1-like
Gene Name: SPECC1L
Alternative Gene Name: CYTSA, KIAA0376
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033444: 95%, ENSRNOG00000001303: 93%
Entrez Gene ID: 23384
Uniprot ID: Q69YQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT
• Gene Sequence: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT
• Gene ID - Mouse: ENSMUSG00000033444
• Gene ID - Rat: ENSRNOG00000001303
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.