Description
Product Description
Protein Description: sperm antigen with calponin homology and coiled-coil domains 1
Gene Name: SPECC1
Alternative Gene Name: CYTSB, FLJ36955, HCMOGT-1, NSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042331: 82%, ENSRNOG00000002903: 80%
Entrez Gene ID: 92521
Uniprot ID: Q5M775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPECC1
Alternative Gene Name: CYTSB, FLJ36955, HCMOGT-1, NSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042331: 82%, ENSRNOG00000002903: 80%
Entrez Gene ID: 92521
Uniprot ID: Q5M775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLNKPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRT |
Gene Sequence | MRSAAKPWNPAIRAGGHGPDRVRPLPAASSGMKSSKSSTSLAFESRLSRLKRASSEDTLNKPGSTAASGVVRLKKTATAGAISELTESRLRSGTGAFTTTKRT |
Gene ID - Mouse | ENSMUSG00000042331 |
Gene ID - Rat | ENSRNOG00000002903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SPECC1 pAb (ATL-HPA061073) | |
Datasheet | Anti SPECC1 pAb (ATL-HPA061073) Datasheet (External Link) |
Vendor Page | Anti SPECC1 pAb (ATL-HPA061073) at Atlas Antibodies |
Documents & Links for Anti SPECC1 pAb (ATL-HPA061073) | |
Datasheet | Anti SPECC1 pAb (ATL-HPA061073) Datasheet (External Link) |
Vendor Page | Anti SPECC1 pAb (ATL-HPA061073) |