Protein Description: speedy/RINGO cell cycle regulator family member A
Gene Name: SPDYA
Alternative Gene Name: Ringo3, SPDY1, SPY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052525: 97%, ENSRNOG00000004534: 94%
Entrez Gene ID: 245711
Uniprot ID: Q5MJ70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPDYA
Alternative Gene Name: Ringo3, SPDY1, SPY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052525: 97%, ENSRNOG00000004534: 94%
Entrez Gene ID: 245711
Uniprot ID: Q5MJ70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS |
Documents & Links for Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) | |
Datasheet | Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) at Atlas |
Documents & Links for Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) | |
Datasheet | Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPDYA pAb (ATL-HPA066214 w/enhanced validation) |