Description
Product Description
Protein Description: spermatogenesis associated, serine-rich 2-like
Gene Name: SPATS2L
Alternative Gene Name: DNAPTP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038305: 83%, ENSRNOG00000016012: 85%
Entrez Gene ID: 26010
Uniprot ID: Q9NUQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPATS2L
Alternative Gene Name: DNAPTP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038305: 83%, ENSRNOG00000016012: 85%
Entrez Gene ID: 26010
Uniprot ID: Q9NUQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GEITHPKNNYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFN |
Gene Sequence | GEITHPKNNYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFN |
Gene ID - Mouse | ENSMUSG00000038305 |
Gene ID - Rat | ENSRNOG00000016012 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SPATS2L pAb (ATL-HPA066310) | |
Datasheet | Anti SPATS2L pAb (ATL-HPA066310) Datasheet (External Link) |
Vendor Page | Anti SPATS2L pAb (ATL-HPA066310) at Atlas Antibodies |
Documents & Links for Anti SPATS2L pAb (ATL-HPA066310) | |
Datasheet | Anti SPATS2L pAb (ATL-HPA066310) Datasheet (External Link) |
Vendor Page | Anti SPATS2L pAb (ATL-HPA066310) |