Anti SPATS2 pAb (ATL-HPA066105)

Catalog No:
ATL-HPA066105-25
$447.00

Description

Product Description

Protein Description: spermatogenesis associated, serine-rich 2
Gene Name: SPATS2
Alternative Gene Name: FLJ13117, SCR59, SPATA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051934: 73%, ENSRNOG00000052307: 69%
Entrez Gene ID: 65244
Uniprot ID: Q86XZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS
Gene Sequence SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS
Gene ID - Mouse ENSMUSG00000051934
Gene ID - Rat ENSRNOG00000052307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SPATS2 pAb (ATL-HPA066105)
Datasheet Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link)
Vendor Page Anti SPATS2 pAb (ATL-HPA066105) at Atlas Antibodies

Documents & Links for Anti SPATS2 pAb (ATL-HPA066105)
Datasheet Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link)
Vendor Page Anti SPATS2 pAb (ATL-HPA066105)

Product Description

Protein Description: spermatogenesis associated, serine-rich 2
Gene Name: SPATS2
Alternative Gene Name: FLJ13117, SCR59, SPATA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051934: 73%, ENSRNOG00000052307: 69%
Entrez Gene ID: 65244
Uniprot ID: Q86XZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS
Gene Sequence SGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS
Gene ID - Mouse ENSMUSG00000051934
Gene ID - Rat ENSRNOG00000052307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SPATS2 pAb (ATL-HPA066105)
Datasheet Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link)
Vendor Page Anti SPATS2 pAb (ATL-HPA066105) at Atlas Antibodies

Documents & Links for Anti SPATS2 pAb (ATL-HPA066105)
Datasheet Anti SPATS2 pAb (ATL-HPA066105) Datasheet (External Link)
Vendor Page Anti SPATS2 pAb (ATL-HPA066105)