Protein Description: spermatogenesis associated 33
Gene Name: SPATA33
Alternative Gene Name: C16orf55, FLJ31606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048478: 55%, ENSRNOG00000038239: 53%
Entrez Gene ID: 124045
Uniprot ID: Q96N06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPATA33
Alternative Gene Name: C16orf55, FLJ31606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048478: 55%, ENSRNOG00000038239: 53%
Entrez Gene ID: 124045
Uniprot ID: Q96N06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSHLKE |
Documents & Links for Anti SPATA33 pAb (ATL-HPA073096) | |
Datasheet | Anti SPATA33 pAb (ATL-HPA073096) Datasheet (External Link) |
Vendor Page | Anti SPATA33 pAb (ATL-HPA073096) at Atlas |
Documents & Links for Anti SPATA33 pAb (ATL-HPA073096) | |
Datasheet | Anti SPATA33 pAb (ATL-HPA073096) Datasheet (External Link) |
Vendor Page | Anti SPATA33 pAb (ATL-HPA073096) |