Description
Product Description
Protein Description: spermatogenesis associated 12
Gene Name: SPATA12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032064: 34%, ENSRNOG00000010260: 34%
Entrez Gene ID: 353324
Uniprot ID: Q7Z6I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SPATA12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032064: 34%, ENSRNOG00000010260: 34%
Entrez Gene ID: 353324
Uniprot ID: Q7Z6I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIA |
Gene Sequence | TQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIA |
Gene ID - Mouse | ENSMUSG00000032064 |
Gene ID - Rat | ENSRNOG00000010260 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) | |
Datasheet | Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) | |
Datasheet | Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) |