Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation)

Catalog No:
ATL-HPA075578-25
$447.00

Description

Product Description

Protein Description: spermatogenesis associated 12
Gene Name: SPATA12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032064: 34%, ENSRNOG00000010260: 34%
Entrez Gene ID: 353324
Uniprot ID: Q7Z6I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIA
Gene Sequence TQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIA
Gene ID - Mouse ENSMUSG00000032064
Gene ID - Rat ENSRNOG00000010260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation)
Datasheet Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation)

Product Description

Protein Description: spermatogenesis associated 12
Gene Name: SPATA12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032064: 34%, ENSRNOG00000010260: 34%
Entrez Gene ID: 353324
Uniprot ID: Q7Z6I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIA
Gene Sequence TQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIA
Gene ID - Mouse ENSMUSG00000032064
Gene ID - Rat ENSRNOG00000010260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation)
Datasheet Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SPATA12 pAb (ATL-HPA075578 w/enhanced validation)