Anti SPANXN4 pAb (ATL-HPA059094)

Atlas Antibodies

Catalog No: ATL-HPA059094-25

• 

Product Description

Protein Description: SPANX family member N4
Gene Name: SPANXN4
Alternative Gene Name: CT11.9, SPANX-N4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059395: 28%, ENSRNOG00000049817: 31%
Entrez Gene ID: 441525
Uniprot ID: Q5MJ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRN
• Gene Sequence: PTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRN
• Gene ID - Mouse: ENSMUSG00000059395
• Gene ID - Rat: ENSRNOG00000049817
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.