Anti SPAG4 pAb (ATL-HPA061789)

Atlas Antibodies

Catalog No: ATL-HPA061789-25

• 

Product Description

Protein Description: sperm associated antigen 4
Gene Name: SPAG4
Alternative Gene Name: CT127, SUN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038180: 87%, ENSRNOG00000048056: 86%
Entrez Gene ID: 6676
Uniprot ID: Q9NPE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSDITLQHPPPSVEHTGGANSAPRDFAVFGLQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGH
• Gene Sequence: LSDITLQHPPPSVEHTGGANSAPRDFAVFGLQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGH
• Gene ID - Mouse: ENSMUSG00000038180
• Gene ID - Rat: ENSRNOG00000048056
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.